MAPRE1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2614T
Article Name: MAPRE1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2614T
Supplier Catalog Number: CNA2614T
Alternative Catalog Number: MBL-CNA2614T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 134-268 of human MAPRE1 (NP_036457.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 30kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: ETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 134-268 of human MAPRE1 (NP_036457.1).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200