Cytokeratin 15 (KRT15) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2660S
Article Name: Cytokeratin 15 (KRT15) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2660S
Supplier Catalog Number: CNA2660S
Alternative Catalog Number: MBL-CNA2660S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Cytokeratin 15 (KRT15) (P19012).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 49kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LLSGNEKITMQNLNDRLASYLDKVRALEEANADLEVKIHDWYQKQTPTSPECDYSQYFKTIEELRDKIMATTIDNSRVILEIDNARLAADDFRLKYENELA
Target: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Cytokeratin 15 (KRT15) (P19012).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200