CLEC4D Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2697T
Article Name: CLEC4D Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2697T
Supplier Catalog Number: CNA2697T
Alternative Catalog Number: MBL-CNA2697T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-215 of human CLEC4D (NP_525126.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 25kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: TDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 100-215 of human CLEC4D (NP_525126.2).
Application Dilute: WB: WB,1:1000 - 1:4000|IF/ICC,1:50 - 1:200