EGF Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA2720S
| Article Name: |
EGF Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA2720S |
| Supplier Catalog Number: |
CNA2720S |
| Alternative Catalog Number: |
MBL-CNA2720S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
DOT, WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 971-1023 of human EGF (NP_001954.2). |
| Conjugation: |
Unconjugated |
| Clonality: |
Polyclonal |
| Molecular Weight: |
134kDa |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
| Target: |
Recombinant fusion protein containing a sequence corresponding to amino acids 971-1023 of human EGF (NP_001954.2). |
| Application Dilute: |
WB: DB,1:500 - 1:2000|WB,1:500 - 1:2000 |
