IGF2BP2/IMP2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2749S
Article Name: IGF2BP2/IMP2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2749S
Supplier Catalog Number: CNA2749S
Alternative Catalog Number: MBL-CNA2749S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human IGF2BP2/IMP2 (NP_006539.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 66kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: NFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK
Target: A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human IGF2BP2/IMP2 (NP_006539.3).
Application Dilute: WB: WB,1:200 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100