Acetyl-Histone H3-K23 Rabbit mAb, Clone: [ARC2683], Unconjugated, Monoclonal

Catalog Number: MBL-CNA2770S
Article Name: Acetyl-Histone H3-K23 Rabbit mAb, Clone: [ARC2683], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA2770S
Supplier Catalog Number: CNA2770S
Alternative Catalog Number: MBL-CNA2770S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: All, Human, Mouse, Rat
Immunogen: A synthetic acetylated peptide around K23 of human Histone H3 (P68431).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2683]
Molecular Weight: 16kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Target: A synthetic acetylated peptide around K23 of human Histone H3 (P68431).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200