Acetyl-Histone H3-K27 Rabbit mAb, Clone: [ARC53670], Unconjugated, Monoclonal

Catalog Number: MBL-CNA2771P
Article Name: Acetyl-Histone H3-K27 Rabbit mAb, Clone: [ARC53670], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA2771P
Supplier Catalog Number: CNA2771P
Alternative Catalog Number: MBL-CNA2771P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ChIP, DOT, ICC, IF, IHC-P, IP, WB
Species Reactivity: All, Human, Mouse, Rat
Immunogen: A synthetic acetylated peptide around K27 of human Histone H3 (P68431).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC53670]
Molecular Weight: 15kDa
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
Target: A synthetic acetylated peptide around K27 of human Histone H3 (P68431).
Application Dilute: WB: DB,1:500 - 1:2000|WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,1:50 - 1:200|IF/ICC,1:50 - 1:200|ChIP,1:50 - 1:200|CUT&Tag, 105 cells /2 µg