Rad51 Rabbit mAb, Clone: [ARC0764], Unconjugated, Monoclonal

Catalog Number: MBL-CNA2829S
Article Name: Rad51 Rabbit mAb, Clone: [ARC0764], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA2829S
Supplier Catalog Number: CNA2829S
Alternative Catalog Number: MBL-CNA2829S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ChIP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rad51 (Q06609).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0764]
Molecular Weight: 37kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEII
Target: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rad51 (Q06609).
Application Dilute: WB: WB,1:500 - 1:2000|ChIP,1:50 - 1:200