ARL2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA2830T
Article Name: |
ARL2 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA2830T |
Supplier Catalog Number: |
CNA2830T |
Alternative Catalog Number: |
MBL-CNA2830T |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human ARL2 (NP_001658.2). |
Conjugation: |
Unconjugated |
Clonality: |
Polyclonal |
Molecular Weight: |
21kDa |
Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.01% thimerosal,50% glycerol |
Sequence: |
MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD |
Target: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human ARL2 (NP_001658.2). |
Application Dilute: |
WB: WB,1:500 - 1:2000 |