AQP10 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2888S
Article Name: AQP10 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2888S
Supplier Catalog Number: CNA2888S
Alternative Catalog Number: MBL-CNA2888S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 209-301 of human AQP10 (NP_536354.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 32kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: CGIPLNPARDLGPRLFTYVAGWGPEVFSAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 209-301 of human AQP10 (NP_536354.2).
Application Dilute: WB: WB,1:200 - 1:1000