DDB1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2896T
Article Name: DDB1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2896T
Supplier Catalog Number: CNA2896T
Alternative Catalog Number: MBL-CNA2896T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 800-900 of human DDB1 (Q16531).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 127kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: EVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
Target: A synthetic peptide corresponding to a sequence within amino acids 800-900 of human DDB1 (Q16531).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100