Gelsolin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2952S
Article Name: Gelsolin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2952S
Supplier Catalog Number: CNA2952S
Alternative Catalog Number: MBL-CNA2952S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 543-782 of human Gelsolin (NP_000168.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 86kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: PMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPSFVGWFLGWDDDYWSVDPLDRAMAELAA
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 543-782 of human Gelsolin (NP_000168.1).
Application Dilute: WB: WB,1:500 - 1:2000