GFRA3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA2955T
Article Name: GFRA3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA2955T
Supplier Catalog Number: CNA2955T
Alternative Catalog Number: MBL-CNA2955T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 32-240 of human GFRA3 (NP_001487.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 45kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: DPLPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLCLKFAMLCTLNDKCDRLRKAYGEACSGPHCQRHVCLRQLLTFFEKAAEPHAQGLLLCPCAPNDRGCGERRRNTIAPNCA
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 32-240 of human GFRA3 (NP_001487.2).
Application Dilute: WB: WB,1:500 - 1:2000