GRIN2B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA3056S1
Article Name: GRIN2B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA3056S1
Supplier Catalog Number: CNA3056S1
Alternative Catalog Number: MBL-CNA3056S1
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1185-1484 of human GRIN2B (NP_000825.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 166kDa
Buffer: PBS with 0.09% Sodium azide,50% glycerol
Source: Rabbit
Sequence: DKHGVVSGVPAPWEKNLTNVEWEDRSGGNFCRSCPSKLHNYSTTVTGQNSGRQACIRCEACKKAGNLYDISEDNSLQELDQPAAPVAVTSNASTTKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAALAPRSVSLKDKGRFMDGSPYAHMFEMSAGESTFANNKSSVPTAGHHHHNNPGGGYMLSKSLYPDRVTQNPFIPTFGDDQCLLHGSKSYFFRQPTVAGASKARPDFRALVTNKPVVSALHGAV
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1185-1484 of human GRIN2B (NP_000825.2).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200