Rad50 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA3078S
Article Name: Rad50 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA3078S
Supplier Catalog Number: CNA3078S
Alternative Catalog Number: MBL-CNA3078S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rad50 (NP_005723.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 154kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MSRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGNTFVHDPKVAQETDVRAQIRLQFRDVNGELIAVQRSM
Target: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rad50 (NP_005723.2).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:20 - 1:50