ADCYAP1R1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA3120T
Article Name: ADCYAP1R1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA3120T
Supplier Catalog Number: CNA3120T
Alternative Catalog Number: MBL-CNA3120T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-140 of human ADCYAP1R1 (NP_001109.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 53kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: CIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYE
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 25-140 of human ADCYAP1R1 (NP_001109.2).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200