DNMT3A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA3169T
Article Name: DNMT3A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA3169T
Supplier Catalog Number: CNA3169T
Alternative Catalog Number: MBL-CNA3169T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human DNMT3A (NP_072046.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 102kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: EVQNKPMIEWALGGFQPSGPKGLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTAEKPKVKEIIDERTRERLVYEVRQKCRNIEDICISCGSL
Target: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human DNMT3A (NP_072046.2).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:20