NRF1 Rabbit mAb, Clone: [ARC0768], Unconjugated, Monoclonal

Catalog Number: MBL-CNA3252S
Article Name: NRF1 Rabbit mAb, Clone: [ARC0768], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA3252S
Supplier Catalog Number: CNA3252S
Alternative Catalog Number: MBL-CNA3252S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ChIP, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human NRF1 (Q16656).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0768]
Molecular Weight: 54kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: LVPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSAVADGEVEQNWATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGA
Target: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human NRF1 (Q16656).
Application Dilute: WB: WB,1:500 - 1:2000| IHC-P,1:50 - 1:200|IP,1:50 - 1:100|ChIP,1:20 - 1:50