WDR5 Rabbit mAb, Clone: [ARC0769], Unconjugated, Monoclonal

Catalog Number: MBL-CNA3259S
Article Name: WDR5 Rabbit mAb, Clone: [ARC0769], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA3259S
Supplier Catalog Number: CNA3259S
Alternative Catalog Number: MBL-CNA3259S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 235-334 of human WDR5 (NP_060058.1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0769]
Molecular Weight: 37kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: DNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Target: A synthetic peptide corresponding to a sequence within amino acids 235-334 of human WDR5 (NP_060058.1).
Application Dilute: WB: WB,1:500 - 1:1000