E2F2 Rabbit mAb, Clone: [ARC1940], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA3297S
Article Name: |
E2F2 Rabbit mAb, Clone: [ARC1940], Unconjugated, Monoclonal |
Biozol Catalog Number: |
MBL-CNA3297S |
Supplier Catalog Number: |
CNA3297S |
Alternative Catalog Number: |
MBL-CNA3297S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 303-395 of human E2F2 (Q14209). |
Conjugation: |
Unconjugated |
Clonality: |
Monoclonal |
Clone Designation: |
[ARC1940] |
Molecular Weight: |
48kDa |
Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Sequence: |
CPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAPPPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLA |
Target: |
Recombinant fusion protein containing a sequence corresponding to amino acids 303-395 of human E2F2 (Q14209). |
Application Dilute: |
WB: WB,1:500 - 1:1000 |