KIF5A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA3303T
Article Name: KIF5A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA3303T
Supplier Catalog Number: CNA3303T
Alternative Catalog Number: MBL-CNA3303T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 933-1032 of human KIF5A (NP_004975.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 117kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: TNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 933-1032 of human KIF5A (NP_004975.2).
Application Dilute: WB: WB,1:1000 - 1:3000|IF/ICC,1:50 - 1:200