RPA70/RPA1 Rabbit mAb, Clone: [ARC0773], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA3367S
Article Name: |
RPA70/RPA1 Rabbit mAb, Clone: [ARC0773], Unconjugated, Monoclonal |
Biozol Catalog Number: |
MBL-CNA3367S |
Supplier Catalog Number: |
CNA3367S |
Alternative Catalog Number: |
MBL-CNA3367S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
ChIP, IP, WB |
Species Reactivity: |
Human, Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPA70/RPA1 (P27694). |
Conjugation: |
Unconjugated |
Clonality: |
Monoclonal |
Clone Designation: |
[ARC0773] |
Molecular Weight: |
68kDa |
Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Sequence: |
MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELE |
Target: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPA70/RPA1 (P27694). |
Application Dilute: |
WB: WB,1:500 - 1:2000|IP,1:500 - 1:1000|ChIP,1:500 - 1:1000 |