YB-1/YBX1 Rabbit mAb, Clone: [ARC0797], Unconjugated, Monoclonal

Catalog Number: MBL-CNA3534S
Article Name: YB-1/YBX1 Rabbit mAb, Clone: [ARC0797], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA3534S
Supplier Catalog Number: CNA3534S
Alternative Catalog Number: MBL-CNA3534S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ChIP, ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 225-324 of human YB-1/YBX1 (P67809).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0797]
Molecular Weight: 36kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE
Target: A synthetic peptide corresponding to a sequence within amino acids 225-324 of human YB-1/YBX1 (P67809).
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000|ChIP,1:500 - 1:1000