HDAC6 Rabbit mAb, Clone: [ARC0805], Unconjugated, Monoclonal

Catalog Number: MBL-CNA3572S
Article Name: HDAC6 Rabbit mAb, Clone: [ARC0805], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA3572S
Supplier Catalog Number: CNA3572S
Alternative Catalog Number: MBL-CNA3572S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC6 (Q9UBN7).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0805]
Molecular Weight: 131kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCL
Target: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC6 (Q9UBN7).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000