STING/TMEM173 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA3575S1
Article Name: STING/TMEM173 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA3575S1
Supplier Catalog Number: CNA3575S1
Alternative Catalog Number: MBL-CNA3575S1
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 150-379 of human STING/TMEM173 (NP_938023.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 42kDa
Buffer: PBS with 0.09% Sodium azide,50% glycerol
Source: Rabbit
Sequence: KGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 150-379 of human STING/TMEM173 (NP_938023.1).
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:100 - 1:500