PFKM Rabbit mAb, Clone: [ARC0819], Unconjugated, Monoclonal

Catalog Number: MBL-CNA3671S
Article Name: PFKM Rabbit mAb, Clone: [ARC0819], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA3671S
Supplier Catalog Number: CNA3671S
Alternative Catalog Number: MBL-CNA3671S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Fructose 6 Phosphate Kinase (P08237).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0819]
Molecular Weight: 85kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: FVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEA
Target: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Fructose 6 Phosphate Kinase (P08237).
Application Dilute: WB: WB,1:500 - 1:1000