mGluR2 Rabbit mAb, Clone: [ARC2070], Unconjugated, Monoclonal

Catalog Number: MBL-CNA3673S
Article Name: mGluR2 Rabbit mAb, Clone: [ARC2070], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA3673S
Supplier Catalog Number: CNA3673S
Alternative Catalog Number: MBL-CNA3673S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 773-872 of human mGluR2 (Q14416).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2070]
Molecular Weight: 96kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: WLAFLPIFYVTSSDYRVQTTTMCVSVSLSGSVVLGCLFAPKLHIILFQPQKNVVSHRAPTSRFGSAAARASSSLGQGSGSQFVPTVCNGREVVDSTTSSL
Target: A synthetic peptide corresponding to a sequence within amino acids 773-872 of human mGluR2 (Q14416).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200