HP1 alpha/CBX5 Rabbit mAb, Clone: [ARC0244], Unconjugated, Monoclonal

Catalog Number: MBL-CNA3741S
Article Name: HP1 alpha/CBX5 Rabbit mAb, Clone: [ARC0244], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA3741S
Supplier Catalog Number: CNA3741S
Alternative Catalog Number: MBL-CNA3741S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 92-191 of human HP1 alpha/CBX5 (P45973).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0244]
Molecular Weight: 22kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: SNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS
Target: A synthetic peptide corresponding to a sequence within amino acids 92-191 of human HP1 alpha/CBX5 (P45973).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000