COX6A1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA3798S
Article Name: COX6A1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA3798S
Supplier Catalog Number: CNA3798S
Alternative Catalog Number: MBL-CNA3798S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-109 of human COX6A1 (NP_004364.2).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 12kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: SSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 25-109 of human COX6A1 (NP_004364.2).
Application Dilute: WB: WB,1:200 - 1:2000|IHC-P,1:20 - 1:200|IF/ICC,1:50 - 1:200