NUDEL/NDEL1 Rabbit mAb, Clone: [ARC0835], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA3799S
Article Name: |
NUDEL/NDEL1 Rabbit mAb, Clone: [ARC0835], Unconjugated, Monoclonal |
Biozol Catalog Number: |
MBL-CNA3799S |
Supplier Catalog Number: |
CNA3799S |
Alternative Catalog Number: |
MBL-CNA3799S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human, Mouse, Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUDEL/NDEL1 (Q9GZM8). |
Conjugation: |
Unconjugated |
Clonality: |
Monoclonal |
Clone Designation: |
[ARC0835] |
Molecular Weight: |
38kDa |
Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Sequence: |
MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQSYKQVSVLEDD |
Target: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUDEL/NDEL1 (Q9GZM8). |
Application Dilute: |
WB: WB,1:500 - 1:2000 |