BAF57/SMARCE1 Rabbit mAb, Clone: [ARC0839], Unconjugated, Monoclonal

Catalog Number: MBL-CNA3814S
Article Name: BAF57/SMARCE1 Rabbit mAb, Clone: [ARC0839], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA3814S
Supplier Catalog Number: CNA3814S
Alternative Catalog Number: MBL-CNA3814S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 2-100 of human BAF57/SMARCE1 (NP_003070.3).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0839]
Molecular Weight: 47kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: SKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKII
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 2-100 of human BAF57/SMARCE1 (NP_003070.3).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200