DDB1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA3827S
Article Name: DDB1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA3827S
Supplier Catalog Number: CNA3827S
Alternative Catalog Number: MBL-CNA3827S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1000 to the C-terminus of human DDB1 (NP_001914.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 127kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: LGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
Target: A synthetic peptide corresponding to a sequence within amino acids 1000 to the C-terminus of human DDB1 (NP_001914.3).
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:500|IP,1:500 - 1:1000