FTO Rabbit mAb, Clone: [ARC0851], Unconjugated, Monoclonal

Catalog Number: MBL-CNA3861S
Article Name: FTO Rabbit mAb, Clone: [ARC0851], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA3861S
Supplier Catalog Number: CNA3861S
Alternative Catalog Number: MBL-CNA3861S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FTO (Q9C0B1).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0851]
Molecular Weight: 58kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MKRTPTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLILREASSVSEELHKEVQEAFLTLHKHGCLFRDLVRIQGKDLLTPVSRILIG
Target: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FTO (Q9C0B1).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:100 - 1:500