AKR1C3 Rabbit mAb, Clone: [ARC0857], Unconjugated, Monoclonal

Catalog Number: MBL-CNA3884S
Article Name: AKR1C3 Rabbit mAb, Clone: [ARC0857], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA3884S
Supplier Catalog Number: CNA3884S
Alternative Catalog Number: MBL-CNA3884S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human AKR1C3 (P42330).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0857]
Molecular Weight: 37kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: SKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
Target: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human AKR1C3 (P42330).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200