CENPC Rabbit mAb, Clone: [ARC2097], Unconjugated, Monoclonal

Catalog Number: MBL-CNA3975S
Article Name: CENPC Rabbit mAb, Clone: [ARC2097], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA3975S
Supplier Catalog Number: CNA3975S
Alternative Catalog Number: MBL-CNA3975S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 380-520 of human CENPC (Q03188).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2097]
Molecular Weight: 107kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: VLDTSYALIGETVNNYRSTKYEMYSKNAEKPSRSKRTIKQKQRRKFMAKPAEEQLDVGQSKDENIHTSHITQDEFQRNSDRNMEEHEEMGNDCVSKKQMPPVGSKKSSTRKDKEESKKKRFSSESKNKLVPEEVTSTVTKS
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 380-520 of human CENPC (Q03188).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200