NDUFAF1 Rabbit mAb, Clone: [ARC2091], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4007S
Article Name: NDUFAF1 Rabbit mAb, Clone: [ARC2091], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4007S
Supplier Catalog Number: CNA4007S
Alternative Catalog Number: MBL-CNA4007S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human NDUFAF1 (Q9Y375).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2091]
Molecular Weight: 38kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MALVHKLLRGTYFLRKFSKPTSALYPFLGIRFAEYSSSLQKPVASPGKASSQRKTEGDLQGDHQKEVALDITSSEEKPDVSFDKAIRDEAIYHFRLLKDEIVDHWRGPEGHPLHEVLLEQAKVVWQFRGKEDLDKWTVTSDKTIGGRSEV
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human NDUFAF1 (Q9Y375).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200