TTR Rabbit mAb, Clone: [ARC0892], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4067S
Article Name: TTR Rabbit mAb, Clone: [ARC0892], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4067S
Supplier Catalog Number: CNA4067S
Alternative Catalog Number: MBL-CNA4067S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 68-147 of human TTR (P02766).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0892]
Molecular Weight: 16kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: KTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE
Target: A synthetic peptide corresponding to a sequence within amino acids 68-147 of human TTR (P02766).
Application Dilute: WB: WB,1:500 - 1:2000