CD3G Rabbit mAb, Clone: [ARC2105], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4085S
Article Name: CD3G Rabbit mAb, Clone: [ARC2105], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4085S
Supplier Catalog Number: CNA4085S
Alternative Catalog Number: MBL-CNA4085S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: FC, ICC, IF, IHC-P, WB
Species Reactivity: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 83-182 of human CD3G (P09693).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2105]
Molecular Weight: 20kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN
Target: A synthetic peptide corresponding to a sequence within amino acids 83-182 of human CD3G (P09693).
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|FC,1:50 - 1:200