alpha Sarcoglycan (SGCA) Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: alpha Sarcoglycan (SGCA) Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: MBL-CNA4109T
• Supplier Catalog Number: CNA4109T
• Alternative Catalog Number: MBL-CNA4109T
• Manufacturer: MBL
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IF, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 60-290 of human alpha Sarcoglycan (alpha Sarcoglycan (SGCA)) (NP_000014.1).
• Conjugation: Unconjugated

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 43kDa
• Buffer: PBS with 0.01% thimerosal,50% glycerol
• Source: Rabbit
• Purity: Affinity purification
• Form: PBS with 0.01% thimerosal,50% glycerol
• Sequence: ITYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGSATPEDRGLQVIEVTAYNRDSFDTTRQRLVLEIGDPEGPLLPYQAEFLVRSHDAEEVLPSTPASRFLSALGGLWEPGELQLLNVTSALDRGGRVPLPIEGRKEGVYIKVGSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHFRVDWCNVTLVDKSVPEPADEVPTPGDGILEHDPFFCPPTEAPDRDFLVDA
• Target: Recombinant fusion protein containing a sequence corresponding to amino acids 60-290 of human alpha Sarcoglycan (alpha Sarcoglycan (SGCA)) (NP_000014.1).

Application Notes

• Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200