SRP9 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA4124S
Article Name: SRP9 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA4124S
Supplier Catalog Number: CNA4124S
Alternative Catalog Number: MBL-CNA4124S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SRP9 (NP_003124.1).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 10kDa
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human SRP9 (NP_003124.1).
Application Dilute: WB: WB,1:1000 - 1:2000|IF/ICC,1:50 - 1:200