Prostatic Acid Phosphatase (ACPP) Rabbit mAb, Clone: [ARC2124], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4138S
Article Name: Prostatic Acid Phosphatase (ACPP) Rabbit mAb, Clone: [ARC2124], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4138S
Supplier Catalog Number: CNA4138S
Alternative Catalog Number: MBL-CNA4138S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Prostatic Acid Phosphatase(PAP/ACPP) (P15309).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC2124]
Molecular Weight: 45kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRHGDRSPIDTFPTDPIKESSWPQGFGQLTQLGMEQHYELGEYIRKRYRKFLNESYKHE
Target: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Prostatic Acid Phosphatase(PAP/ACPP) (P15309).
Application Dilute: WB: WB,1:500 - 1:1000