SFRP4 Rabbit mAb, Clone: [ARC0923], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4189S
Article Name: SFRP4 Rabbit mAb, Clone: [ARC0923], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4189S
Supplier Catalog Number: CNA4189S
Alternative Catalog Number: MBL-CNA4189S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 201-300 of human SFRP4 (Q6FHJ7).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0923]
Molecular Weight: 40kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: AKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQD
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 201-300 of human SFRP4 (Q6FHJ7).
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200