tPA/PLAT Rabbit mAb, Clone: [ARC0928], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4210S
Article Name: tPA/PLAT Rabbit mAb, Clone: [ARC0928], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4210S
Supplier Catalog Number: CNA4210S
Alternative Catalog Number: MBL-CNA4210S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 463-562 of human tPA/tPA/PLAT (P00750).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0928]
Molecular Weight: 63kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: LKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP
Target: A synthetic peptide corresponding to a sequence within amino acids 463-562 of human tPA/tPA/PLAT (P00750).
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200