CGGBP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA4231T
Article Name: CGGBP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA4231T
Supplier Catalog Number: CNA4231T
Alternative Catalog Number: MBL-CNA4231T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-167 of human CGGBP1 (NP_003654.3).
Conjugation: Unconjugated
Clonality: Polyclonal
Molecular Weight: 19kDa
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 1-167 of human CGGBP1 (NP_003654.3).
Application Dilute: WB: WB,1:500 - 1:2000