CCR8 Rabbit mAb, Clone: [ARC0956], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4288S
Article Name: CCR8 Rabbit mAb, Clone: [ARC0956], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4288S
Supplier Catalog Number: CNA4288S
Alternative Catalog Number: MBL-CNA4288S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-355 of human CCR8 (P51685).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0956]
Molecular Weight: 41kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: FWVPFNVVLFLTSLHSMHILDGCSISQQLTYATHVTEIISFTHCCVNPVIYAFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSSVDYIL
Target: A synthetic peptide corresponding to a sequence within amino acids 250-355 of human CCR8 (P51685).
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200