CD147/BSG Rabbit mAb, Clone: [ARC0964], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4310S
Article Name: CD147/BSG Rabbit mAb, Clone: [ARC0964], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4310S
Supplier Catalog Number: CNA4310S
Alternative Catalog Number: MBL-CNA4310S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD147/BSG (P35613).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0964]
Molecular Weight: 19kDa/22kDa/29kDa/42kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: EEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGE
Target: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD147/BSG (P35613).
Application Dilute: WB: WB,1:500 - 1:1000