HMGA1 Rabbit mAb, Clone: [ARC1060], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4343S
Article Name: HMGA1 Rabbit mAb, Clone: [ARC1060], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4343S
Supplier Catalog Number: CNA4343S
Alternative Catalog Number: MBL-CNA4343S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ChIP, ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-107 of human HMGA1 (P17096).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1060]
Molecular Weight: 12kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
Target: A synthetic peptide corresponding to a sequence within amino acids 1-107 of human HMGA1 (P17096).
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ChIP,1:50 - 1:200