Cytokeratin 7 (CK7) Rabbit mAb, Clone: [ARC0978], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4357S
Article Name: Cytokeratin 7 (CK7) Rabbit mAb, Clone: [ARC0978], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4357S
Supplier Catalog Number: CNA4357S
Alternative Catalog Number: MBL-CNA4357S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 291-463 of human Cytokeratin 7 (KRT7) (P08729).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC0978]
Molecular Weight: 51kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: QAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASAS
Target: Recombinant fusion protein containing a sequence corresponding to amino acids 291-463 of human Cytokeratin 7 (KRT7) (P08729).
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200