DKC1 Rabbit mAb, Clone: [ARC1063], Unconjugated, Monoclonal
Catalog Number:
MBL-CNA4407S
| Article Name: |
DKC1 Rabbit mAb, Clone: [ARC1063], Unconjugated, Monoclonal |
| Biozol Catalog Number: |
MBL-CNA4407S |
| Supplier Catalog Number: |
CNA4407S |
| Alternative Catalog Number: |
MBL-CNA4407S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC-P, WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 300-400 of human DKC1 (O60832). |
| Conjugation: |
Unconjugated |
| Clonality: |
Monoclonal |
| Clone Designation: |
[ARC1063] |
| Molecular Weight: |
58kDa |
| Buffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequence: |
VMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDHGIVAKIKRVIMERDTYPRKWGLGPKASQKKLMIKQGLLDK |
| Target: |
A synthetic peptide corresponding to a sequence within amino acids 300-400 of human DKC1 (O60832). |
| Application Dilute: |
WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200 |
