[KO Validated] CRMP2/DPYSL2 Rabbit mAb, Clone: [ARC1123], Unconjugated, Monoclonal

Catalog Number: MBL-CNA4411S
Article Name: [KO Validated] CRMP2/DPYSL2 Rabbit mAb, Clone: [ARC1123], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA4411S
Supplier Catalog Number: CNA4411S
Alternative Catalog Number: MBL-CNA4411S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 473-572 of human CRMP2/DPYSL2 (Q16555).
Conjugation: Unconjugated
Clonality: Monoclonal
Clone Designation: [ARC1123]
Molecular Weight: 62kDa
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: PFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG
Target: A synthetic peptide corresponding to a sequence within amino acids 473-572 of human CRMP2/DPYSL2 (Q16555).
Application Dilute: WB: WB,1:500 - 1:5000|IF/ICC,1:50 - 1:200